Lineage for d3ccef1 (3cce F:1-119)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566728Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2566729Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2566746Protein Ribosomal protein L7ae [55319] (7 species)
  7. 2566754Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 2566795Domain d3ccef1: 3cce F:1-119 [156265]
    Other proteins in same PDB: d3cce11, d3cce21, d3cce31, d3cceb1, d3cced1, d3cceh1, d3ccei1, d3ccej1, d3ccek1, d3ccel1, d3ccen1, d3cceo1, d3ccep1, d3cceq1, d3ccer1, d3cces1, d3ccet1, d3cceu1, d3ccev1, d3ccew1, d3ccex1, d3ccey1, d3ccez1
    automatically matched to d1s72f_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccef1

PDB Entry: 3cce (more details), 2.75 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d3ccef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccef1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOPe Domain Coordinates for d3ccef1:

Click to download the PDB-style file with coordinates for d3ccef1.
(The format of our PDB-style files is described here.)

Timeline for d3ccef1: