SCOP 1.71: Domain d1hlm__: 1hlm -

Lineage for d1hlm__ (1hlm -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, different isoforms [46524] (1 species)

7. Species Sea cucumber (Caudina (Molpadia) arenicola) [46525] (2 PDB entries)

8. Domain d1hlm__: 1hlm - [15626]
   complexed with cyn, hem

Details for d1hlm__

PDB Entry: 1hlm, 2.9 Å

PDB Description: amino acid sequence of a globin from the sea cucumber caudina (molpadia) arenicola

SCOP Domain Sequences for d1hlm__:

Sequence; same for both SEQRES and ATOM records:

>d1hlm__ a.1.1.2 (-) Hemoglobin, different isoforms {Sea cucumber (Caudina (Molpadia) arenicola)}
gatqsfqsvgdltpaekdlirstwdqlmthrtgfvadvfirifhndptaqrkfpqmagls
paelrtsrqmhahairvsalmttyidemdtevlpellatltrthdknhvgkknydlfgkv
lmeaikaelgvgftkqvhdawaktfaivqgvlitkhas

Timeline for d1hlm__:

• d1hlm__ first appeared (with stable ids) in SCOP 1.55
  
• d1hlm__ appears in SCOP 1.69
  
• d1hlm__ is called d1hlma_ in SCOP 1.73
  
• d1hlm__ appears in the current release, SCOPe 2.07, called d1hlma_