Lineage for d1hlma_ (1hlm A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301055Protein Hemoglobin, different isoforms [46524] (1 species)
  7. 2301056Species Caudina arenicola, also known as Molpadia arenicola [TaxId:7698] [46525] (2 PDB entries)
  8. 2301058Domain d1hlma_: 1hlm A: [15626]
    complexed with cyn, hem

Details for d1hlma_

PDB Entry: 1hlm (more details), 2.9 Å

PDB Description: amino acid sequence of a globin from the sea cucumber caudina (molpadia) arenicola
PDB Compounds: (A:) hemoglobin (cyano met)

SCOPe Domain Sequences for d1hlma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlma_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}
gatqsfqsvgdltpaekdlirstwdqlmthrtgfvadvfirifhndptaqrkfpqmagls
paelrtsrqmhahairvsalmttyidemdtevlpellatltrthdknhvgkknydlfgkv
lmeaikaelgvgftkqvhdawaktfaivqgvlitkhas

SCOPe Domain Coordinates for d1hlma_:

Click to download the PDB-style file with coordinates for d1hlma_.
(The format of our PDB-style files is described here.)

Timeline for d1hlma_: