Lineage for d1hlb__ (1hlb -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531482Protein Hemoglobin, different isoforms [46524] (1 species)
  7. 531483Species Sea cucumber (Caudina (Molpadia) arenicola) [46525] (2 PDB entries)
  8. 531484Domain d1hlb__: 1hlb - [15625]
    complexed with hem

Details for d1hlb__

PDB Entry: 1hlb (more details), 2.5 Å

PDB Description: structural analysis of monomeric hemichrome and dimeric cyanomet hemoglobins from caudina arenicola

SCOP Domain Sequences for d1hlb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlb__ a.1.1.2 (-) Hemoglobin, different isoforms {Sea cucumber (Caudina (Molpadia) arenicola)}
ggtlaiqaqgdltlaqkkivrktwhqlmrnktsfvtdvfirifaydpsaqnkfpqmagms
asqlrssrqmqahairvssimseyveeldsdilpellatlarthdlnkvgadhynlfakv
lmealqaelgsdfnektrdawakafsvvqavllvkhg

SCOP Domain Coordinates for d1hlb__:

Click to download the PDB-style file with coordinates for d1hlb__.
(The format of our PDB-style files is described here.)

Timeline for d1hlb__: