Lineage for d3cc7z1 (3cc7 Z:35-106)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1706394Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1706395Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
    automatically mapped to Pfam PF01780
  6. 1706396Protein Ribosomal protein L37ae [57831] (1 species)
  7. 1706397Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 1706414Domain d3cc7z1: 3cc7 Z:35-106 [156243]
    Other proteins in same PDB: d3cc711, d3cc721, d3cc731, d3cc7b1, d3cc7d1, d3cc7f1, d3cc7h1, d3cc7i1, d3cc7j1, d3cc7k1, d3cc7l1, d3cc7n1, d3cc7o1, d3cc7p1, d3cc7q1, d3cc7r1, d3cc7s1, d3cc7t1, d3cc7u1, d3cc7v1, d3cc7w1, d3cc7x1, d3cc7y1
    automatically matched to d1s72z_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cc7z1

PDB Entry: 3cc7 (more details), 2.7 Å

PDB Description: Structure of Anisomycin resistant 50S Ribosomal Subunit: 23S rRNA mutation C2487U
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d3cc7z1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc7z1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk
petpggktvrrs

SCOPe Domain Coordinates for d3cc7z1:

Click to download the PDB-style file with coordinates for d3cc7z1.
(The format of our PDB-style files is described here.)

Timeline for d3cc7z1: