Lineage for d1ithb_ (1ith B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) 
Protein Hemoglobin [46522] (1 species) Species Innkeeper worm (Urechis caupo) [TaxId:6431] [46523] (1 PDB entry) 
Domain d1ithb_: 1ith B: [15624]
Details for d1ithb_
PDB Entry: 1ith (more details), 2.5 Å
PDB Description: structure determination and refinement of homotetrameric hemoglobin from urechis caupo at 2.5 angstroms resolution
SCOP Domain Sequences for d1ithb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ithb_ a.1.1.2 (B:) Hemoglobin {Innkeeper worm (Urechis caupo)}
gltaaqikaiqdhwflnikgclqaaadsiffkyltaypgdlaffhkfssvplyglrsnpa
ykaqtltvinyldkvvdalggnagalmkakvpshdamgitpkhfgqllklvggvfqeefs
adpttvaawgdaagvlvaamk
SCOP Domain Coordinates for d1ithb_:
Click to download the PDB-style file with coordinates for d1ithb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ithb_:
- d1ithb_ appears in SCOP 1.57
- d1ithb_ appears in the current release, SCOPe 2.08
View in 3D
