Lineage for d3cc7v1 (3cc7 V:1-65)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897178Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 897220Domain d3cc7v1: 3cc7 V:1-65 [156239]
    Other proteins in same PDB: d3cc721, d3cc7b1, d3cc7f1, d3cc7h1, d3cc7i1, d3cc7p1, d3cc7r1, d3cc7s1, d3cc7y1, d3cc7z1
    automatically matched to d1w2bu_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant

Details for d3cc7v1

PDB Entry: 3cc7 (more details), 2.7 Å

PDB Description: Structure of Anisomycin resistant 50S Ribosomal Subunit: 23S rRNA mutation C2487U
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOP Domain Sequences for d3cc7v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc7v1 i.1.1.2 (V:1-65) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOP Domain Coordinates for d3cc7v1:

Click to download the PDB-style file with coordinates for d3cc7v1.
(The format of our PDB-style files is described here.)

Timeline for d3cc7v1: