![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
![]() | Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
![]() | Family d.12.1.1: L23p [54190] (1 protein) automatically mapped to Pfam PF00276 |
![]() | Protein Ribosomal protein L23 [54191] (4 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries) Uniprot P12732 |
![]() | Domain d3cc7s1: 3cc7 S:1-81 [156236] Other proteins in same PDB: d3cc711, d3cc721, d3cc731, d3cc7b1, d3cc7d1, d3cc7f1, d3cc7h1, d3cc7i1, d3cc7j1, d3cc7k1, d3cc7l1, d3cc7n1, d3cc7o1, d3cc7p1, d3cc7q1, d3cc7r1, d3cc7t1, d3cc7u1, d3cc7v1, d3cc7w1, d3cc7x1, d3cc7y1, d3cc7z1 automatically matched to d1jj2r_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3cc7 (more details), 2.7 Å
SCOPe Domain Sequences for d3cc7s1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cc7s1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]} swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg ekkavvrlsedddaqevasri
Timeline for d3cc7s1: