SCOP 1.67: Domain d1itha_: 1ith A:

Lineage for d1itha_ (1ith A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (20 proteins)
   Heme-binding protein

6. Protein Hemoglobin [46522] (1 species)

7. Species Innkeeper worm (Urechis caupo) [TaxId:6431] [46523] (1 PDB entry)

8. Domain d1itha_: 1ith A: [15623]

Details for d1itha_

PDB Entry: 1ith, 2.5 Å

PDB Description: structure determination and refinement of homotetrameric hemoglobin from urechis caupo at 2.5 angstroms resolution

SCOP Domain Sequences for d1itha_:

Sequence; same for both SEQRES and ATOM records:

>d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo)}
gltaaqikaiqdhwflnikgclqaaadsiffkyltaypgdlaffhkfssvplyglrsnpa
ykaqtltvinyldkvvdalggnagalmkakvpshdamgitpkhfgqllklvggvfqeefs
adpttvaawgdaagvlvaamk

Timeline for d1itha_:

• d1itha_ first appeared (with stable ids) in SCOP 1.55
  
• d1itha_ appears in SCOP 1.65
  
• d1itha_ appears in SCOP 1.69
  
• d1itha_ appears in the current release, SCOPe 2.08