Lineage for d1itha_ (1ith A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686137Protein Hemoglobin [46522] (1 species)
  7. 2686138Species Innkeeper worm (Urechis caupo) [TaxId:6431] [46523] (1 PDB entry)
  8. 2686139Domain d1itha_: 1ith A: [15623]
    complexed with cyn, hem

Details for d1itha_

PDB Entry: 1ith (more details), 2.5 Å

PDB Description: structure determination and refinement of homotetrameric hemoglobin from urechis caupo at 2.5 angstroms resolution
PDB Compounds: (A:) hemoglobin (cyano met)

SCOPe Domain Sequences for d1itha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]}
gltaaqikaiqdhwflnikgclqaaadsiffkyltaypgdlaffhkfssvplyglrsnpa
ykaqtltvinyldkvvdalggnagalmkakvpshdamgitpkhfgqllklvggvfqeefs
adpttvaawgdaagvlvaamk

SCOPe Domain Coordinates for d1itha_:

Click to download the PDB-style file with coordinates for d1itha_.
(The format of our PDB-style files is described here.)

Timeline for d1itha_: