Lineage for d3cc7k1 (3cc7 K:1-132)

  1. Root: SCOPe 2.07
  2. 2592940Class i: Low resolution protein structures [58117] (25 folds)
  3. 2592941Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2592942Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2593959Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2594094Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2594241Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2594262Domain d3cc7k1: 3cc7 K:1-132 [156229]
    Other proteins in same PDB: d3cc721, d3cc7b1, d3cc7f1, d3cc7h1, d3cc7i1, d3cc7p1, d3cc7r1, d3cc7s1, d3cc7y1, d3cc7z1
    automatically matched to d1w2bj_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cc7k1

PDB Entry: 3cc7 (more details), 2.7 Å

PDB Description: Structure of Anisomycin resistant 50S Ribosomal Subunit: 23S rRNA mutation C2487U
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d3cc7k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc7k1 i.1.1.2 (K:1-132) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d3cc7k1:

Click to download the PDB-style file with coordinates for d3cc7k1.
(The format of our PDB-style files is described here.)

Timeline for d3cc7k1: