![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.3: L30e-like [55315] (4 families) ![]() |
![]() | Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
![]() | Protein Ribosomal protein L7ae [55319] (7 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries) Uniprot P12743 |
![]() | Domain d3cc7f1: 3cc7 F:1-119 [156225] Other proteins in same PDB: d3cc711, d3cc721, d3cc731, d3cc7b1, d3cc7d1, d3cc7h1, d3cc7i1, d3cc7j1, d3cc7k1, d3cc7l1, d3cc7n1, d3cc7o1, d3cc7p1, d3cc7q1, d3cc7r1, d3cc7s1, d3cc7t1, d3cc7u1, d3cc7v1, d3cc7w1, d3cc7x1, d3cc7y1, d3cc7z1 automatically matched to d1s72f_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3cc7 (more details), 2.7 Å
SCOPe Domain Sequences for d3cc7f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cc7f1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]} pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr
Timeline for d3cc7f1: