Lineage for d3cc7b1 (3cc7 B:1-337)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793163Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
    automatically mapped to Pfam PF00297
  6. 2793164Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 2793205Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
    Uniprot P20279
  8. 2793229Domain d3cc7b1: 3cc7 B:1-337 [156223]
    Other proteins in same PDB: d3cc711, d3cc721, d3cc731, d3cc7d1, d3cc7f1, d3cc7h1, d3cc7i1, d3cc7j1, d3cc7k1, d3cc7l1, d3cc7n1, d3cc7o1, d3cc7p1, d3cc7q1, d3cc7r1, d3cc7s1, d3cc7t1, d3cc7u1, d3cc7v1, d3cc7w1, d3cc7x1, d3cc7y1, d3cc7z1
    automatically matched to d1jj2b_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cc7b1

PDB Entry: 3cc7 (more details), 2.7 Å

PDB Description: Structure of Anisomycin resistant 50S Ribosomal Subunit: 23S rRNA mutation C2487U
PDB Compounds: (B:) 50S ribosomal protein L3P

SCOPe Domain Sequences for d3cc7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc7b1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOPe Domain Coordinates for d3cc7b1:

Click to download the PDB-style file with coordinates for d3cc7b1.
(The format of our PDB-style files is described here.)

Timeline for d3cc7b1: