![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
![]() | Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) ![]() interrupted alpha-helix automatically mapped to Pfam PF00832 |
![]() | Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein) |
![]() | Protein Ribosomal protein L39e [48664] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries) Uniprot P22452 |
![]() | Domain d3cc721: 3cc7 2:1-49 [156221] Other proteins in same PDB: d3cc711, d3cc731, d3cc7b1, d3cc7d1, d3cc7f1, d3cc7h1, d3cc7i1, d3cc7j1, d3cc7k1, d3cc7l1, d3cc7n1, d3cc7o1, d3cc7p1, d3cc7q1, d3cc7r1, d3cc7s1, d3cc7t1, d3cc7u1, d3cc7v1, d3cc7w1, d3cc7x1, d3cc7y1, d3cc7z1 automatically matched to 1VQ4 2:1-49 complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3cc7 (more details), 2.7 Å
SCOPe Domain Sequences for d3cc721:
Sequence, based on SEQRES records: (download)
>d3cc721 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]} gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde
>d3cc721 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]} gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde
Timeline for d3cc721: