Lineage for d3cc711 (3cc7 1:1-56)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1070374Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1070375Protein 50S subunit [58125] (6 species)
  7. 1070524Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1070555Domain d3cc711: 3cc7 1:1-56 [156220]
    Other proteins in same PDB: d3cc721, d3cc7b1, d3cc7f1, d3cc7h1, d3cc7i1, d3cc7p1, d3cc7r1, d3cc7s1, d3cc7y1, d3cc7z1
    automatically matched to d1w2bz_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cc711

PDB Entry: 3cc7 (more details), 2.7 Å

PDB Description: Structure of Anisomycin resistant 50S Ribosomal Subunit: 23S rRNA mutation C2487U
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d3cc711:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc711 i.1.1.2 (1:1-56) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d3cc711:

Click to download the PDB-style file with coordinates for d3cc711.
(The format of our PDB-style files is described here.)

Timeline for d3cc711: