Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Ascaris hemoglobin, domain 1 [46520] (1 species) |
Species Pig roundworm (Ascaris suum) [TaxId:6253] [46521] (1 PDB entry) |
Domain d1asha_: 1ash A: [15622] complexed with hem, oxy |
PDB Entry: 1ash (more details), 2.15 Å
SCOPe Domain Sequences for d1asha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]} anktrelcmkslehakvdtsnearqdgidlykhmfenypplrkyfksreeytaedvqndp ffakqgqkillachvlcatyddretfnaytrelldrhardhvhmppevwtdfwklfeeyl gkkttldeptkqawheigrefakeink
Timeline for d1asha_: