SCOPe 2.03: Domain d1asha_: 1ash A:

Lineage for d1asha_ (1ash A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Ascaris hemoglobin, domain 1 [46520] (1 species)

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [46521] (1 PDB entry)

8. Domain d1asha_: 1ash A: [15622]
   complexed with hem, oxy

Details for d1asha_

PDB Entry: 1ash, 2.15 Å

PDB Description: the structure of ascaris hemoglobin domain i at 2.2 angstroms resolution: molecular features of oxygen avidity

PDB Compounds: (A:) hemoglobin (oxy)

SCOPe Domain Sequences for d1asha_:

Sequence; same for both SEQRES and ATOM records:

>d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}
anktrelcmkslehakvdtsnearqdgidlykhmfenypplrkyfksreeytaedvqndp
ffakqgqkillachvlcatyddretfnaytrelldrhardhvhmppevwtdfwklfeeyl
gkkttldeptkqawheigrefakeink

Timeline for d1asha_:

• d1asha_ first appeared (with stable ids) in SCOP 1.55, called d1ash__
  
• d1asha_ appears in SCOPe 2.02
  
• d1asha_ appears in SCOPe 2.04
  
• d1asha_ appears in the current release, SCOPe 2.08