Lineage for d1ash__ (1ash -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 349290Protein Ascaris hemoglobin, domain 1 [46520] (1 species)
  7. 349291Species Pig roundworm (Ascaris suum) [TaxId:6253] [46521] (1 PDB entry)
  8. 349292Domain d1ash__: 1ash - [15622]
    complexed with hem, oxy

Details for d1ash__

PDB Entry: 1ash (more details), 2.15 Å

PDB Description: the structure of ascaris hemoglobin domain i at 2.2 angstroms resolution: molecular features of oxygen avidity

SCOP Domain Sequences for d1ash__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ash__ a.1.1.2 (-) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum)}
anktrelcmkslehakvdtsnearqdgidlykhmfenypplrkyfksreeytaedvqndp
ffakqgqkillachvlcatyddretfnaytrelldrhardhvhmppevwtdfwklfeeyl
gkkttldeptkqawheigrefakeink

SCOP Domain Coordinates for d1ash__:

Click to download the PDB-style file with coordinates for d1ash__.
(The format of our PDB-style files is described here.)

Timeline for d1ash__: