Class g: Small proteins [56992] (92 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) |
Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein) automatically mapped to Pfam PF01780 |
Protein Ribosomal protein L37ae [57831] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries) Uniprot P60619 |
Domain d3cc4z1: 3cc4 Z:35-106 [156219] Other proteins in same PDB: d3cc411, d3cc421, d3cc431, d3cc4b1, d3cc4d1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4p1, d3cc4q1, d3cc4r1, d3cc4s1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4y1 automatically matched to d1s72z_ complexed with anm, cd, cl, k, mg, na, sr |
PDB Entry: 3cc4 (more details), 2.7 Å
SCOPe Domain Sequences for d3cc4z1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cc4z1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]} sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk petpggktvrrs
Timeline for d3cc4z1: