Lineage for d3cc4y1 (3cc4 Y:95-236)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111376Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2111434Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 2111435Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 2111436Protein Ribosomal protein L32e [52044] (1 species)
  7. 2111437Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 2111484Domain d3cc4y1: 3cc4 Y:95-236 [156218]
    Other proteins in same PDB: d3cc411, d3cc421, d3cc431, d3cc4b1, d3cc4d1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4p1, d3cc4q1, d3cc4r1, d3cc4s1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4z1
    automatically matched to d1jj2x_
    complexed with anm, cd, cl, k, mg, na, sr

Details for d3cc4y1

PDB Entry: 3cc4 (more details), 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d3cc4y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc4y1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d3cc4y1:

Click to download the PDB-style file with coordinates for d3cc4y1.
(The format of our PDB-style files is described here.)

Timeline for d3cc4y1: