Lineage for d3cc4v1 (3cc4 V:1-65)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897178Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 897304Domain d3cc4v1: 3cc4 V:1-65 [156215]
    Other proteins in same PDB: d3cc421, d3cc4b1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4p1, d3cc4r1, d3cc4s1, d3cc4y1, d3cc4z1
    automatically matched to d1w2bu_
    complexed with 1ma, anm, cd, cl, k, mg, na, omg, omu, psu, sr, ur3

Details for d3cc4v1

PDB Entry: 3cc4 (more details), 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOP Domain Sequences for d3cc4v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc4v1 i.1.1.2 (V:1-65) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOP Domain Coordinates for d3cc4v1:

Click to download the PDB-style file with coordinates for d3cc4v1.
(The format of our PDB-style files is described here.)

Timeline for d3cc4v1: