Lineage for d3cc4p1 (3cc4 P:1-143)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333978Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 2333979Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
    automatically mapped to Pfam PF01280
  5. 2333980Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 2333981Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 2333982Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 2334020Domain d3cc4p1: 3cc4 P:1-143 [156209]
    Other proteins in same PDB: d3cc411, d3cc421, d3cc431, d3cc4b1, d3cc4d1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4q1, d3cc4r1, d3cc4s1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4y1, d3cc4z1
    automatically matched to d1s72p_
    complexed with anm, cd, cl, k, mg, na, sr

Details for d3cc4p1

PDB Entry: 3cc4 (more details), 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d3cc4p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc4p1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d3cc4p1:

Click to download the PDB-style file with coordinates for d3cc4p1.
(The format of our PDB-style files is described here.)

Timeline for d3cc4p1: