Lineage for d3cc4n1 (3cc4 N:1-186)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1070374Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1070375Protein 50S subunit [58125] (6 species)
  7. 1070524Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1070659Domain d3cc4n1: 3cc4 N:1-186 [156207]
    Other proteins in same PDB: d3cc421, d3cc4b1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4p1, d3cc4r1, d3cc4s1, d3cc4y1, d3cc4z1
    automatically matched to d1w2bm_
    complexed with anm, cd, cl, k, mg, na, sr

Details for d3cc4n1

PDB Entry: 3cc4 (more details), 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
PDB Compounds: (N:) 50S ribosomal protein L18P

SCOPe Domain Sequences for d3cc4n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc4n1 i.1.1.2 (N:1-186) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOPe Domain Coordinates for d3cc4n1:

Click to download the PDB-style file with coordinates for d3cc4n1.
(The format of our PDB-style files is described here.)

Timeline for d3cc4n1: