Lineage for d3cc4h1 (3cc4 H:4-166)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859091Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 859229Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 859230Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 859231Protein Ribosomal protein L10e [54688] (2 species)
  7. 859232Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries)
    Uniprot P60617
  8. 859261Domain d3cc4h1: 3cc4 H:4-166 [156202]
    Other proteins in same PDB: d3cc411, d3cc421, d3cc431, d3cc4b1, d3cc4d1, d3cc4f1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4p1, d3cc4q1, d3cc4r1, d3cc4s1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4y1, d3cc4z1
    automatically matched to d1s72h_
    complexed with 1ma, anm, cd, cl, k, mg, na, omg, omu, psu, sr, ur3

Details for d3cc4h1

PDB Entry: 3cc4 (more details), 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
PDB Compounds: (H:) 50S ribosomal protein L10e

SCOP Domain Sequences for d3cc4h1:

Sequence, based on SEQRES records: (download)

>d3cc4h1 d.41.4.1 (H:4-166) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscri

Sequence, based on observed residues (ATOM records): (download)

>d3cc4h1 d.41.4.1 (H:4-166) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscri

SCOP Domain Coordinates for d3cc4h1:

Click to download the PDB-style file with coordinates for d3cc4h1.
(The format of our PDB-style files is described here.)

Timeline for d3cc4h1: