Lineage for d3cc4f1 (3cc4 F:1-119)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566728Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2566729Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2566746Protein Ribosomal protein L7ae [55319] (7 species)
  7. 2566754Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 2566792Domain d3cc4f1: 3cc4 F:1-119 [156201]
    Other proteins in same PDB: d3cc411, d3cc421, d3cc431, d3cc4b1, d3cc4d1, d3cc4h1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4p1, d3cc4q1, d3cc4r1, d3cc4s1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4y1, d3cc4z1
    automatically matched to d1s72f_
    complexed with anm, cd, cl, k, mg, na, sr

Details for d3cc4f1

PDB Entry: 3cc4 (more details), 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d3cc4f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc4f1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOPe Domain Coordinates for d3cc4f1:

Click to download the PDB-style file with coordinates for d3cc4f1.
(The format of our PDB-style files is described here.)

Timeline for d3cc4f1: