Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (3 families) |
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
Protein Ribosomal protein L7ae [55319] (7 species) |
Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries) Uniprot P12743 |
Domain d3cc4f1: 3cc4 F:1-119 [156201] Other proteins in same PDB: d3cc411, d3cc421, d3cc431, d3cc4b1, d3cc4d1, d3cc4h1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4p1, d3cc4q1, d3cc4r1, d3cc4s1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4y1, d3cc4z1 automatically matched to d1s72f_ complexed with anm, cd, cl, k, mg, na, sr |
PDB Entry: 3cc4 (more details), 2.7 Å
SCOPe Domain Sequences for d3cc4f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cc4f1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]} pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr
Timeline for d3cc4f1: