Lineage for d1f5pe_ (1f5p E:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 482Protein Lamprey globin [46518] (1 species)
  7. 483Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 507Domain d1f5pe_: 1f5p E: [15620]

Details for d1f5pe_

PDB Entry: 1f5p (more details), 2.9 Å

PDB Description: 2.9 angstrom crystal structure of lamprey hemoglobin that has been exposed to carbon monoxide.

SCOP Domain Sequences for d1f5pe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5pe_ a.1.1.2 (E:) Lamprey globin {Sea lamprey (Petromyzon marinus)}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOP Domain Coordinates for d1f5pe_:

Click to download the PDB-style file with coordinates for d1f5pe_.
(The format of our PDB-style files is described here.)

Timeline for d1f5pe_: