![]() | Class i: Low resolution protein structures [58117] (26 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.2: Large subunit [58124] (1 protein) |
![]() | Protein 50S subunit [58125] (6 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
![]() | Domain d3cc411: 3cc4 1:1-56 [156196] Other proteins in same PDB: d3cc421, d3cc4b1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4p1, d3cc4r1, d3cc4s1, d3cc4y1, d3cc4z1 automatically matched to d1w2bz_ complexed with 1ma, anm, cd, cl, k, mg, na, omg, omu, psu, sr, ur3 |
PDB Entry: 3cc4 (more details), 2.7 Å
SCOP Domain Sequences for d3cc411:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cc411 i.1.1.2 (1:1-56) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]} tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
Timeline for d3cc411: