Lineage for d3cc2y1 (3cc2 Y:95-236)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459800Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2459860Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 2459861Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 2459862Protein Ribosomal protein L32e [52044] (1 species)
  7. 2459863Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 2459882Domain d3cc2y1: 3cc2 Y:95-236 [156194]
    Other proteins in same PDB: d3cc211, d3cc221, d3cc231, d3cc2b1, d3cc2c1, d3cc2d1, d3cc2f1, d3cc2g1, d3cc2h1, d3cc2i1, d3cc2j1, d3cc2k1, d3cc2l1, d3cc2m1, d3cc2n1, d3cc2o1, d3cc2p1, d3cc2q1, d3cc2r1, d3cc2s1, d3cc2t1, d3cc2u1, d3cc2v1, d3cc2w1, d3cc2x1, d3cc2z1
    automatically matched to d1jj2x_
    complexed with cd, cl, k, mg, na

Details for d3cc2y1

PDB Entry: 3cc2 (more details), 2.4 Å

PDB Description: The Refined Crystal Structure of the Haloarcula Marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution with rrnA Sequence for the 23S rRNA and Genome-derived Sequences for r-Proteins
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d3cc2y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc2y1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d3cc2y1:

Click to download the PDB-style file with coordinates for d3cc2y1.
(The format of our PDB-style files is described here.)

Timeline for d3cc2y1: