Lineage for d3cc2m1 (3cc2 M:1-193)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897178Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 897186Domain d3cc2m1: 3cc2 M:1-193 [156182]
    Other proteins in same PDB: d3cc221, d3cc2b1, d3cc2c1, d3cc2f1, d3cc2h1, d3cc2i1, d3cc2p1, d3cc2r1, d3cc2s1, d3cc2y1, d3cc2z1
    automatically matched to d1w2bl_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d3cc2m1

PDB Entry: 3cc2 (more details), 2.4 Å

PDB Description: The Refined Crystal Structure of the Haloarcula Marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution with rrnA Sequence for the 23S rRNA and Genome-derived Sequences for r-Proteins
PDB Compounds: (M:) 50S ribosomal protein L15e

SCOP Domain Sequences for d3cc2m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc2m1 i.1.1.2 (M:1-193) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
arsaysyirdawknpgdgqlaelqwqrqqewrnegaverierptrldkarsqgykakqgv
ivarvsvrkgsarkrrhkagrrskrqgvtritrrkdiqrvaeerasrtfpnlrvlnsysv
gqdgrqkwhevilidpnhpaiqndddlswicaddqadrvfrgltgagrrnrglsgkgkgs
ektrpslrsnggk

SCOP Domain Coordinates for d3cc2m1:

Click to download the PDB-style file with coordinates for d3cc2m1.
(The format of our PDB-style files is described here.)

Timeline for d3cc2m1: