![]() | Class i: Low resolution protein structures [58117] (26 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.2: Large subunit [58124] (1 protein) |
![]() | Protein 50S subunit [58125] (6 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
![]() | Domain d3cc2d1: 3cc2 D:10-174 [156174] Other proteins in same PDB: d3cc221, d3cc2b1, d3cc2c1, d3cc2f1, d3cc2h1, d3cc2i1, d3cc2p1, d3cc2r1, d3cc2s1, d3cc2y1, d3cc2z1 automatically matched to d1w2bd_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3 |
PDB Entry: 3cc2 (more details), 2.4 Å
SCOP Domain Sequences for d3cc2d1:
Sequence, based on SEQRES records: (download)
>d3cc2d1 i.1.1.2 (D:10-174) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]} fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev
>d3cc2d1 i.1.1.2 (D:10-174) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]} fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk hrlnpadavafiestydvev
Timeline for d3cc2d1:
![]() Domains from other chains: (mouse over for more information) d3cc211, d3cc221, d3cc231, d3cc2b1, d3cc2c1, d3cc2f1, d3cc2g1, d3cc2h1, d3cc2i1, d3cc2j1, d3cc2k1, d3cc2l1, d3cc2m1, d3cc2n1, d3cc2o1, d3cc2p1, d3cc2q1, d3cc2r1, d3cc2s1, d3cc2t1, d3cc2u1, d3cc2v1, d3cc2w1, d3cc2x1, d3cc2y1, d3cc2z1 |