SCOP 1.75: Domain d3cc2d1: 3cc2 D:10-174

Lineage for d3cc2d1 (3cc2 D:10-174)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)

8. Domain d3cc2d1: 3cc2 D:10-174 [156174]
   Other proteins in same PDB: d3cc221, d3cc2b1, d3cc2c1, d3cc2f1, d3cc2h1, d3cc2i1, d3cc2p1, d3cc2r1, d3cc2s1, d3cc2y1, d3cc2z1
   automatically matched to d1w2bd_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d3cc2d1

PDB Entry: 3cc2, 2.4 Å

PDB Description: The Refined Crystal Structure of the Haloarcula Marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution with rrnA Sequence for the 23S rRNA and Genome-derived Sequences for r-Proteins

PDB Compounds: (D:) 50S ribosomal protein L5P

SCOP Domain Sequences for d3cc2d1:

Sequence, based on SEQRES records:

>d3cc2d1 i.1.1.2 (D:10-174) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records):

>d3cc2d1 i.1.1.2 (D:10-174) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

Timeline for d3cc2d1:

• d3cc2d1 is new in SCOP 1.75
  
• d3cc2d1 appears in SCOPe 2.01
  
• d3cc2d1 appears in the current release, SCOPe 2.08