Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein 70S ribosome functional complex [58121] (4 species) |
Species Haloarcula marismortui [TaxId:2238] [161279] (1 PDB entry) |
Domain d3cc2c1: 3cc2 C:1-246 [156173] Other proteins in same PDB: d3cc211, d3cc221, d3cc231, d3cc2b1, d3cc2d1, d3cc2f1, d3cc2g1, d3cc2h1, d3cc2i1, d3cc2j1, d3cc2k1, d3cc2l1, d3cc2m1, d3cc2n1, d3cc2o1, d3cc2p1, d3cc2q1, d3cc2r1, d3cc2s1, d3cc2t1, d3cc2u1, d3cc2v1, d3cc2w1, d3cc2x1, d3cc2y1, d3cc2z1 automatically matched to d1giyf_ complexed with cd, cl, k, mg, na |
PDB Entry: 3cc2 (more details), 2.4 Å
SCOPe Domain Sequences for d3cc2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cc2c1 i.1.1.1 (C:1-246) 70S ribosome functional complex {Haloarcula marismortui [TaxId: 2238]} mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes fgsgrgqahvpkqdgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal aevaer
Timeline for d3cc2c1:
View in 3D Domains from other chains: (mouse over for more information) d3cc211, d3cc221, d3cc231, d3cc2b1, d3cc2d1, d3cc2f1, d3cc2g1, d3cc2h1, d3cc2i1, d3cc2j1, d3cc2k1, d3cc2l1, d3cc2m1, d3cc2n1, d3cc2o1, d3cc2p1, d3cc2q1, d3cc2r1, d3cc2s1, d3cc2t1, d3cc2u1, d3cc2v1, d3cc2w1, d3cc2x1, d3cc2y1, d3cc2z1 |