Class b: All beta proteins [48724] (174 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (3 families) duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core |
Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins) contains metal-binding preSET and postSET domains |
Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82206] (11 PDB entries) Uniprot Q8WTS6 52-336 |
Domain d3cbpa2: 3cbp A:194-363 [156166] Other proteins in same PDB: d3cbpa1 automatically matched to d1o9sa2 protein/DNA complex; complexed with bme, gol, sfg |
PDB Entry: 3cbp (more details), 1.42 Å
SCOPe Domain Sequences for d3cbpa2:
Sequence, based on SEQRES records: (download)
>d3cbpa2 b.85.7.1 (A:194-363) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqat
>d3cbpa2 b.85.7.1 (A:194-363) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf gpikcirtlraveadeeltvaygydheapewyqvelkafqat
Timeline for d3cbpa2: