Lineage for d3cbpa2 (3cbp A:194-363)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2073020Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2073021Family b.85.7.1: Histone lysine methyltransferases [82200] (3 protein domains)
    contains metal-binding preSET and postSET domains
  6. 2073027Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)
  7. 2073028Species Human (Homo sapiens) [TaxId:9606] [82206] (18 PDB entries)
    Uniprot Q8WTS6 52-336
  8. 2073030Domain d3cbpa2: 3cbp A:194-363 [156166]
    Other proteins in same PDB: d3cbpa1
    automatically matched to d1o9sa2
    protein/DNA complex; complexed with bme, gol, sfg

Details for d3cbpa2

PDB Entry: 3cbp (more details), 1.42 Å

PDB Description: Set7/9-ER-Sinefungin complex
PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d3cbpa2:

Sequence, based on SEQRES records: (download)

>d3cbpa2 b.85.7.1 (A:194-363) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqat

Sequence, based on observed residues (ATOM records): (download)

>d3cbpa2 b.85.7.1 (A:194-363) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydheapewyqvelkafqat

SCOPe Domain Coordinates for d3cbpa2:

Click to download the PDB-style file with coordinates for d3cbpa2.
(The format of our PDB-style files is described here.)

Timeline for d3cbpa2: