Class b: All beta proteins [48724] (174 folds) |
Fold b.76: open-sided beta-meander [51086] (2 superfamilies) single sheet formed by beta-hairpin repeats; exposed on both sides in the middle |
Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) 11+ stranded sheet partly folded upon itself at the C-end |
Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein) |
Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82188] (11 PDB entries) Uniprot Q8WTS6 52-366 |
Domain d3cbpa1: 3cbp A:117-193 [156165] Other proteins in same PDB: d3cbpa2 automatically matched to d1n6aa1 complexed with bme, gol, sfg |
PDB Entry: 3cbp (more details), 1.42 Å
SCOP Domain Sequences for d3cbpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cbpa1 b.76.2.1 (A:117-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste egrphfelmpgnsvyhf
Timeline for d3cbpa1: