SCOP 1.75: Domain d3cboa2: 3cbo A:194-364

Lineage for d3cboa2 (3cbo A:194-364)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (3 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
   contains metal-binding preSET and postSET domains

6. Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82206] (11 PDB entries)
   Uniprot Q8WTS6 52-336

8. Domain d3cboa2: 3cbo A:194-364 [156164]
   Other proteins in same PDB: d3cboa1
   automatically matched to d1o9sa2
   complexed with bme, gol, mlz, sah

Details for d3cboa2

PDB Entry: 3cbo, 1.65 Å

PDB Description: SET7/9-ER-AdoHcy complex

PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOP Domain Sequences for d3cboa2:

Sequence, based on SEQRES records:

>d3cboa2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqatq

Sequence, based on observed residues (ATOM records):

>d3cboa2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygyeapewyqvelkafqatq

Timeline for d3cboa2:

• d3cboa2 is new in SCOP 1.75
  
• d3cboa2 appears in SCOPe 2.01
  
• d3cboa2 appears in the current release, SCOPe 2.08