SCOPe 2.07: Domain d3cboa1: 3cbo A:116-193

Lineage for d3cboa1 (3cbo A:116-193)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family)
   11+ stranded sheet partly folded upon itself at the C-end

5. Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)

6. Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82188] (19 PDB entries)
   Uniprot Q8WTS6 52-366

8. Domain d3cboa1: 3cbo A:116-193 [156163]
   Other proteins in same PDB: d3cboa2
   automatically matched to d1n6aa1
   protein/DNA complex; complexed with bme, gol, sah

Details for d3cboa1

PDB Entry: 3cbo, 1.65 Å

PDB Description: SET7/9-ER-AdoHcy complex

PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d3cboa1:

Sequence; same for both SEQRES and ATOM records:

>d3cboa1 b.76.2.1 (A:116-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
eegrphfelmpgnsvyhf

Timeline for d3cboa1:

• d3cboa1 first appeared in SCOP 1.75
  
• d3cboa1 appears in SCOPe 2.06
  
• d3cboa1 appears in the current release, SCOPe 2.08