Lineage for d3cboa1 (3cbo A:116-193)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068816Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2068846Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 2068847Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 2068848Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 2068849Species Human (Homo sapiens) [TaxId:9606] [82188] (18 PDB entries)
    Uniprot Q8WTS6 52-366
  8. 2068852Domain d3cboa1: 3cbo A:116-193 [156163]
    Other proteins in same PDB: d3cboa2
    automatically matched to d1n6aa1
    protein/DNA complex; complexed with bme, gol, sah

Details for d3cboa1

PDB Entry: 3cbo (more details), 1.65 Å

PDB Description: SET7/9-ER-AdoHcy complex
PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d3cboa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cboa1 b.76.2.1 (A:116-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
eegrphfelmpgnsvyhf

SCOPe Domain Coordinates for d3cboa1:

Click to download the PDB-style file with coordinates for d3cboa1.
(The format of our PDB-style files is described here.)

Timeline for d3cboa1: