SCOPe 2.07: Domain d3cbma2: 3cbm A:194-364

Lineage for d3cbma2 (3cbm A:194-364)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
   contains metal-binding preSET and postSET domains

6. Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82206] (19 PDB entries)
   Uniprot Q8WTS6 52-336

8. Domain d3cbma2: 3cbm A:194-364 [156162]
   Other proteins in same PDB: d3cbma1
   automatically matched to d1o9sa2
   protein/DNA complex; complexed with bme, sah

Details for d3cbma2

PDB Entry: 3cbm, 1.69 Å

PDB Description: set7/9-er-adomet complex

PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d3cbma2:

Sequence, based on SEQRES records:

>d3cbma2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqatq

Sequence, based on observed residues (ATOM records):

>d3cbma2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhspeapewyqvelkafqatq

Timeline for d3cbma2:

• d3cbma2 first appeared in SCOP 1.75
  
• d3cbma2 appears in SCOPe 2.06
  
• d3cbma2 appears in the current release, SCOPe 2.08