Class b: All beta proteins [48724] (174 folds) |
Fold b.76: open-sided beta-meander [51086] (2 superfamilies) single sheet formed by beta-hairpin repeats; exposed on both sides in the middle |
Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) 11+ stranded sheet partly folded upon itself at the C-end |
Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein) |
Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82188] (11 PDB entries) Uniprot Q8WTS6 52-366 |
Domain d3cbma1: 3cbm A:116-193 [156161] Other proteins in same PDB: d3cbma2 automatically matched to d1n6aa1 protein/DNA complex; complexed with bme, sah |
PDB Entry: 3cbm (more details), 1.69 Å
SCOPe Domain Sequences for d3cbma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cbma1 b.76.2.1 (A:116-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst eegrphfelmpgnsvyhf
Timeline for d3cbma1: