Lineage for d3cbma1 (3cbm A:116-193)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1137150Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 1137178Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 1137179Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 1137180Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 1137181Species Human (Homo sapiens) [TaxId:9606] [82188] (11 PDB entries)
    Uniprot Q8WTS6 52-366
  8. 1137185Domain d3cbma1: 3cbm A:116-193 [156161]
    Other proteins in same PDB: d3cbma2
    automatically matched to d1n6aa1
    protein/DNA complex; complexed with bme, sah

Details for d3cbma1

PDB Entry: 3cbm (more details), 1.69 Å

PDB Description: set7/9-er-adomet complex
PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d3cbma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cbma1 b.76.2.1 (A:116-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
eegrphfelmpgnsvyhf

SCOPe Domain Coordinates for d3cbma1:

Click to download the PDB-style file with coordinates for d3cbma1.
(The format of our PDB-style files is described here.)

Timeline for d3cbma1: