| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.26: ICP-like [141066] (2 families) ![]() topological variant with similarity to the Cupredoxin-like fold (49502) in the N-terminal region |
| Family b.1.26.1: ICP-like [141067] (2 proteins) PfamB PB014070 automatically mapped to Pfam PF09394 |
| Protein Chagasin [141068] (1 species) |
| Species Trypanosoma cruzi [TaxId:5693] [141069] (8 PDB entries) Uniprot Q966X9 3-110 |
| Domain d3cbjb_: 3cbj B: [156159] automated match to d2fo8a1 complexed with po4 |
PDB Entry: 3cbj (more details), 1.8 Å
SCOPe Domain Sequences for d3cbjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cbjb_ b.1.26.1 (B:) Chagasin {Trypanosoma cruzi [TaxId: 5693]}
shkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppd
skllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan
Timeline for d3cbjb_: