Class a: All alpha proteins [46456] (284 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
Protein Snake phospholipase A2 [48624] (35 species) |
Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (53 PDB entries) Uniprot P59071 |
Domain d3cbid1: 3cbi D:1-133 [156158] automatically matched to d1cl5a_ complexed with ajm, ann |
PDB Entry: 3cbi (more details), 3.15 Å
SCOP Domain Sequences for d3cbid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cbid1 a.133.1.2 (D:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]} sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk c
Timeline for d3cbid1: