Lineage for d3cbid1 (3cbi D:1-133)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777954Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 777955Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 777960Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 778048Protein Snake phospholipase A2 [48624] (35 species)
  7. 778208Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (53 PDB entries)
    Uniprot P59071
  8. 778274Domain d3cbid1: 3cbi D:1-133 [156158]
    automatically matched to d1cl5a_
    complexed with ajm, ann

Details for d3cbid1

PDB Entry: 3cbi (more details), 3.15 Å

PDB Description: Crystal structure of the ternary complex of phospholipase A2 with ajmaline and anisic acid at 3.1 A resolution
PDB Compounds: (D:) Phospholipase A2 VRV-PL-VIIIa

SCOP Domain Sequences for d3cbid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cbid1 a.133.1.2 (D:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOP Domain Coordinates for d3cbid1:

Click to download the PDB-style file with coordinates for d3cbid1.
(The format of our PDB-style files is described here.)

Timeline for d3cbid1: