Lineage for d3cbia_ (3cbi A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015999Protein automated matches [190139] (26 species)
    not a true protein
  7. 2016055Species Daboia russellii [TaxId:97228] [186865] (27 PDB entries)
  8. 2016083Domain d3cbia_: 3cbi A: [156155]
    automated match to d1tjka_
    protein/RNA complex; complexed with ajm, ann

Details for d3cbia_

PDB Entry: 3cbi (more details), 3.15 Å

PDB Description: Crystal structure of the ternary complex of phospholipase A2 with ajmaline and anisic acid at 3.1 A resolution
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d3cbia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cbia_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d3cbia_:

Click to download the PDB-style file with coordinates for d3cbia_.
(The format of our PDB-style files is described here.)

Timeline for d3cbia_: