Lineage for d3c9tb2 (3c9t B:138-306)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584675Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2584676Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2584677Family d.139.1.1: PurM C-terminal domain-like [56043] (7 proteins)
  6. 2584734Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species)
  7. 2584735Species Aquifex aeolicus [TaxId:63363] [118112] (5 PDB entries)
    Uniprot O67883
  8. 2584745Domain d3c9tb2: 3c9t B:138-306 [156143]
    Other proteins in same PDB: d3c9ta1, d3c9ta3, d3c9tb1, d3c9tb3
    automated match to d3c9ta2
    complexed with acp, mg, tps

Details for d3c9tb2

PDB Entry: 3c9t (more details), 2.6 Å

PDB Description: aathil complexed with amppcp and tmp
PDB Compounds: (B:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d3c9tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c9tb2 d.139.1.1 (B:138-306) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvepkgwkhf

SCOPe Domain Coordinates for d3c9tb2:

Click to download the PDB-style file with coordinates for d3c9tb2.
(The format of our PDB-style files is described here.)

Timeline for d3c9tb2: