Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) |
Family d.139.1.1: PurM C-terminal domain-like [56043] (7 proteins) |
Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [118112] (5 PDB entries) Uniprot O67883 |
Domain d3c9tb2: 3c9t B:138-306 [156143] Other proteins in same PDB: d3c9ta1, d3c9ta3, d3c9tb1, d3c9tb3 automated match to d3c9ta2 complexed with acp, mg, tps |
PDB Entry: 3c9t (more details), 2.6 Å
SCOPe Domain Sequences for d3c9tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c9tb2 d.139.1.1 (B:138-306) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]} rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf ggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvepkgwkhf
Timeline for d3c9tb2: