SCOPe 2.03: Domain d3c9ta1: 3c9t A:1-137

Lineage for d3c9ta1 (3c9t A:1-137)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)

6. Protein Thiamine monophosphate kinase (ThiL) N-terminal domain [118030] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [118031] (5 PDB entries)
   Uniprot O67883

8. Domain d3c9ta1: 3c9t A:1-137 [156140]
   Other proteins in same PDB: d3c9ta2, d3c9tb2
   automatically matched to d1vqva1
   complexed with acp, mg, tps

Details for d3c9ta1

PDB Entry: 3c9t, 2.6 Å

PDB Description: aathil complexed with amppcp and tmp

PDB Compounds: (A:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d3c9ta1:

Sequence; same for both SEQRES and ATOM records:

>d3c9ta1 d.79.4.1 (A:1-137) Thiamine monophosphate kinase (ThiL) N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
mrlkelgefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav
gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni
sksekigisvflvgete

Timeline for d3c9ta1:

• d3c9ta1 first appeared in SCOP 1.75
  
• d3c9ta1 appears in SCOPe 2.02
  
• d3c9ta1 appears in SCOPe 2.04
  
• d3c9ta1 appears in the current release, SCOPe 2.08