![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) ![]() |
![]() | Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) |
![]() | Protein Thiamine monophosphate kinase (ThiL) N-terminal domain [118030] (1 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [118031] (5 PDB entries) Uniprot O67883 |
![]() | Domain d3c9ta1: 3c9t A:1-137 [156140] Other proteins in same PDB: d3c9ta2, d3c9tb2 automatically matched to d1vqva1 complexed with acp, mg, tps |
PDB Entry: 3c9t (more details), 2.6 Å
SCOPe Domain Sequences for d3c9ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c9ta1 d.79.4.1 (A:1-137) Thiamine monophosphate kinase (ThiL) N-terminal domain {Aquifex aeolicus [TaxId: 63363]} mrlkelgefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni sksekigisvflvgete
Timeline for d3c9ta1: