Lineage for d3lhbk_ (3lhb K:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 482Protein Lamprey globin [46518] (1 species)
  7. 483Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 501Domain d3lhbk_: 3lhb K: [15614]

Details for d3lhbk_

PDB Entry: 3lhb (more details), 2.7 Å

PDB Description: the 2.7 angstrom crystal structure of deoxygenated hemoglobin from the sea lamprey (petromyzon marinus)

SCOP Domain Sequences for d3lhbk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lhbk_ a.1.1.2 (K:) Lamprey globin {Sea lamprey (Petromyzon marinus)}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adelkksadvrwhaeriinavddavasmddtekmsmklrnlsgkhaksfqvdpeyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOP Domain Coordinates for d3lhbk_:

Click to download the PDB-style file with coordinates for d3lhbk_.
(The format of our PDB-style files is described here.)

Timeline for d3lhbk_: