SCOPe 2.07: Domain d3c9sa2: 3c9s A:138-300

Lineage for d3c9sa2 (3c9s A:138-300)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (7 proteins)

6. Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [118112] (5 PDB entries)
   Uniprot O67883

8. Domain d3c9sa2: 3c9s A:138-300 [156137]
   Other proteins in same PDB: d3c9sa1, d3c9sa3, d3c9sb1, d3c9sb3
   automated match to d3c9ub2
   complexed with acp, mg

Details for d3c9sa2

PDB Entry: 3c9s, 2.2 Å

PDB Description: aathil complexed with amppcp

PDB Compounds: (A:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d3c9sa2:

Sequence; same for both SEQRES and ATOM records:

>d3c9sa2 d.139.1.1 (A:138-300) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep

Timeline for d3c9sa2:

• d3c9sa2 first appeared in SCOP 1.75
  
• d3c9sa2 appears in SCOPe 2.06
  
• d3c9sa2 appears in the current release, SCOPe 2.08