SCOPe 2.03: Domain d3c9rb2: 3c9r B:138-297

Lineage for d3c9rb2 (3c9r B:138-297)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)

6. Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [118112] (5 PDB entries)
   Uniprot O67883

8. Domain d3c9rb2: 3c9r B:138-297 [156135]
   Other proteins in same PDB: d3c9ra1, d3c9rb1
   automatically matched to d1vqva2
   complexed with atp, mg

Details for d3c9rb2

PDB Entry: 3c9r, 2.3 Å

PDB Description: aathil complexed with atp

PDB Compounds: (B:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d3c9rb2:

Sequence; same for both SEQRES and ATOM records:

>d3c9rb2 d.139.1.1 (B:138-297) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveegegvfvdgkk

Timeline for d3c9rb2:

• d3c9rb2 first appeared in SCOP 1.75
  
• d3c9rb2 appears in SCOPe 2.02
  
• d3c9rb2 appears in SCOPe 2.04
  
• d3c9rb2 appears in the current release, SCOPe 2.08