Lineage for d3c9rb1 (3c9r B:1-137)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960238Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2960239Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 2960305Protein Thiamine monophosphate kinase (ThiL) N-terminal domain [118030] (1 species)
  7. 2960306Species Aquifex aeolicus [TaxId:63363] [118031] (5 PDB entries)
    Uniprot O67883
  8. 2960314Domain d3c9rb1: 3c9r B:1-137 [156134]
    Other proteins in same PDB: d3c9ra2, d3c9ra3, d3c9rb2, d3c9rb3
    automated match to d3c9ua1
    complexed with atp, mg

Details for d3c9rb1

PDB Entry: 3c9r (more details), 2.3 Å

PDB Description: aathil complexed with atp
PDB Compounds: (B:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d3c9rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c9rb1 d.79.4.1 (B:1-137) Thiamine monophosphate kinase (ThiL) N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
mrlkelgefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav
gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni
sksekigisvflvgete

SCOPe Domain Coordinates for d3c9rb1:

Click to download the PDB-style file with coordinates for d3c9rb1.
(The format of our PDB-style files is described here.)

Timeline for d3c9rb1: