Lineage for d3c9ra2 (3c9r A:138-300)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1670756Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 1670757Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 1670758Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)
  6. 1670814Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species)
  7. 1670815Species Aquifex aeolicus [TaxId:63363] [118112] (5 PDB entries)
    Uniprot O67883
  8. 1670820Domain d3c9ra2: 3c9r A:138-300 [156133]
    Other proteins in same PDB: d3c9ra1, d3c9rb1
    automated match to d3c9ua2
    complexed with atp, mg

Details for d3c9ra2

PDB Entry: 3c9r (more details), 2.3 Å

PDB Description: aathil complexed with atp
PDB Compounds: (A:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d3c9ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c9ra2 d.139.1.1 (A:138-300) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep

SCOPe Domain Coordinates for d3c9ra2:

Click to download the PDB-style file with coordinates for d3c9ra2.
(The format of our PDB-style files is described here.)

Timeline for d3c9ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c9ra1